Purified Membrane Proteins

Serine palmitoyltransferase small subunit B (Protein ADMP) (Small subunit of serine palmitoyltransferase B) (ssSPTb)

Stimulates the activity of serine palmitoyltransferase (SPT). The composition of the serine palmitoyltransferase (SPT) complex determines the substrate preference, complexes with this subunit showing a clear preference for longer acyl-CoAs. The SPTLC1-SPTLC2-SPTSSB complex shows a strong preference for C18-CoA substrate, while the SPTLC1-SPTLC3-SPTSSB isozyme displays an ability to use a broader range of acyl-CoAs, without apparent preference. May play a role in signal transduction. {ECO:0000269|PubMed:19416851}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

SPTSB_HUMAN

Gene Name:

SPTSSB ADMP C3orf57 SSSPTB

Uniprot Accession:

Q8NFR3

Origin:

Homo sapiens (Human)

Protein family:

SPTSS family, SPTSSB subfamily

Full-length:

76

AA

Mass:

9198

Da

MDLRRVKEYFSWLYYQYQIISCCAVLEPWERSMFNTILLTIIAMVVYTAYVFIPIHIRLAWEFFSKICGYHSTISN

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes