Purified Membrane Proteins

Olfactory receptor 10J5 (Olfactory receptor OR1-28)

Olfactory receptor. Activated by the synthetic floral odorant, lyral, and by alpha-cedrene, a sesquiterpene constituent of cedarwood oil. Its activation increases intracellular Ca(2+) (PubMed:25791473, PubMed:28842679). Acts as a key regulator of myogenesis through its actions on cell migration and adhesion by activating the Ca(2+)-dependent AKT signal transduction pathway (By similarity). Acts also as a regulator of angiogenesis (PubMed:25791473). Moreover, plays a role in the regulation of lipid accumulation in hepatocytes via the cAMP-PKA pathway (PubMed:28842679). May be involved in sperm chemotaxis and motility (By similarity). {ECO:0000250|UniProtKB:Q62007, ECO:0000269|PubMed:25791473, ECO:0000269|PubMed:28842679}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

O10J5_HUMAN

Gene Name:

OR10J5

Uniprot Accession:

Q8NHC4

Origin:

Homo sapiens (Human)

Protein family:

G-protein coupled receptor 1 family

Full-length:

309

AA

Mass:

34401

Da

MKRKNFTEVSEFIFLGFSSFGKHQITLFVVFLTVYILTLVANIIIVTIICIDHHLHTPMYFFLSMLASSETVYTLVIVPRMLLSLIFHNQPISLAGCATQMFFFVILATNNCFLLTAMGYDRYVAICRPLRYTVIMSKGLCAQLVCGSFGIGLTMAVLHVTAMFNLPFCGTVVDHFFCDIYPVMKLSCIDTTINEIINYGVSSFVIFVPIGLIFISYVLVISSILQIASAEGRKKTFATCVSHLTVVIVHCGCASIAYLKPKSESSIEKDLVLSVTYTIITPLLNPVVYSLRNKEVKDALCRVVGRNIS

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes