Purified Membrane Proteins

V-type proton ATPase subunit e 2 (V-ATPase subunit e 2) (Lysosomal 9 kDa H(+)-transporting ATPase V0 subunit e2) (Vacuolar proton pump subunit e 2)

Subunit of the V0 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons (By similarity). V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments and in some cell types, is targeted to the plasma membrane, where it is responsible for acidifying the extracellular environment (By similarity). {ECO:0000250|UniProtKB:Q2KIB5}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

VA0E2_HUMAN

Gene Name:

ATP6V0E2 ATP6V0E2L C7orf32

Uniprot Accession:

Q8NHE4

Origin:

Homo sapiens (Human)

Protein family:

V-ATPase e1/e2 subunit family

Full-length:

81

AA

Mass:

9184

Da

MTAHSFALPVIIFTTFWGLVGIAGPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQLNPLFGPQLKNETIWYVRFLWE

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes