Purified Membrane Proteins

Claudin domain-containing protein 2

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

CLDN2_HUMAN

Gene Name:

CLDND2

Uniprot Accession:

Q8NHS1

Origin:

Homo sapiens (Human)

Protein family:

PMP-22/EMP/MP20 family

Full-length:

167

AA

Mass:

17984

Da

MGVKRSLQSGGILLSLVANVLMVLSTATNYWTRQQEGHSGLWQECNHGICSSIPCQTTLAVTVACMVLAVGVGVVGMVMGLRIRCDEGESLRGQTTSAFLFLGGLLLLTALIGYTVKNAWKNNVFFSWSYFSGWLALPFSILAGFCFLLADMIMQSTDAISGFPVCL

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes