Purified Membrane Proteins

Secretory carrier-associated membrane protein 5 (Secretory carrier membrane protein 5) (hSCAMP5)

Required for the calcium-dependent exocytosis of signal sequence-containing cytokines such as CCL5. Probably acts in cooperation with the SNARE machinery. May play a role in accumulation of expanded polyglutamine (polyQ) protein huntingtin (HTT) in case of endoplasmic reticulum stress by inhibiting the endocytosis pathway. {ECO:0000269|PubMed:19234194}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

SCAM5_HUMAN

Gene Name:

SCAMP5

Uniprot Accession:

Q8TAC9

Origin:

Homo sapiens (Human)

Protein family:

SCAMP family, SCAMP5 subfamily

Full-length:

235

AA

Mass:

26104

Da

MAEKVNNFPPLPKFIPLKPCFYQDFEADIPPQHVSMTKRLYYLWMLNSVTLAVNLVGCLAWLIGGGGATNFGLAFLWLILFTPCSYVCWFRPIYKAFKTDSSFSFMAFFFTFMAQLVISIIQAVGIPGWGVCGWIATISFFGTNIGSAVVMLIPTVMFTVMAVFSFIALSMVHKFYRGSGGSFSKAQEEWTTGAWKNPHVQQAAQNAAMGAAQGAMNQPQTQYSATPNYTYSNEM

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes