Purified Membrane Proteins

CKLF-like MARVEL transmembrane domain-containing protein 2 (Chemokine-like factor superfamily member 2)

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

CKLF2_HUMAN

Gene Name:

CMTM2 CKLFSF2

Uniprot Accession:

Q8TAZ6

Origin:

Homo sapiens (Human)

Protein family:

Chemokine-like factor family

Full-length:

248

AA

Mass:

27496

Da

MAPKAAKGAKPEPAPAPPPPGAKPEEDKKDGKEPSDKPQKAVQDHKEPSDKPQKAVQPKHEVGTRRGCRRYRWELKDSNKEFWLLGHAEIKIRSLGCLIAAMILLSSLTVHPILRLIITMEISFFSFFILLYSFAIHRYIPFILWPISDLFNDLIACAFLVGAVVFAVRSRRSMNLHYLLAVILIGAAGVFAFIDVCLQRNHFRGKKAKKHMLVPPPGKEKGPQQGKGPEPAKPPEPGKPPGPAKGKK

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes