Purified Membrane Proteins

Ganglioside-induced differentiation-associated protein 1 (GDAP1)

Regulates the mitochondrial network by promoting mitochondrial fission. {ECO:0000269|PubMed:16172208}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

GDAP1_HUMAN

Gene Name:

GDAP1

Uniprot Accession:

Q8TB36

Origin:

Homo sapiens (Human)

Protein family:

GST superfamily

Full-length:

358

AA

Mass:

41346

Da

MAERQEEQRGSPPLRAEGKADAEVKLILYHWTHSFSSQKVRLVIAEKALKCEEHDVSLPLSEHNEPWFMRLNSTGEVPVLIHGENIICEATQIIDYLEQTFLDERTPRLMPDKESMYYPRVQHYRELLDSLPMDAYTHGCILHPELTVDSMIPAYATTRIRSQIGNTESELKKLAEENPDLQEAYIAKQKRLKSKLLDHDNVKYLKKILDELEKVLDQVETELQRRNEETPEEGQQPWLCGESFTLADVSLAVTLHRLKFLGFARRNWGNGKRPNLETYYERVLKRKTFNKVLGHVNNILISAVLPTAFRVAKKRAPKVLGTTLVVGLLAGVGYFAFMLFRKRLGSMILAFRPRPNYF

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes