Purified Membrane Proteins

Proline-rich protein 7 (Synaptic proline-rich membrane protein)

Acts as a synapse-to-nucleus messenger to promote NMDA receptor-mediated excitotoxicity in neurons in a JUN-dependent manner (By similarity). Inhibits ubiquitination-mediated degradation and promotes phosphorylation and transcriptional activity of transcription factor JUN (PubMed:27458189). Might play a redundant role in the regulation of T cell receptor signaling (PubMed:21460222). Might promote apoptosis in T cells (PubMed:21460222). {ECO:0000250|UniProtKB:P0C6T3, ECO:0000250|UniProtKB:Q3V0I2, ECO:0000269|PubMed:21460222, ECO:0000269|PubMed:27458189}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

PRR7_HUMAN

Gene Name:

PRR7

Uniprot Accession:

Q8TB68

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

274

AA

Mass:

30930

Da

MVMSQGTYTFLTCFAGFWLIWGLIVLLCCFCSFLRRRLKRRQEERLREQNLRALELEPLELEGSLAGSPPGLAPPQPPPHRSRLEAPAHAHSHPHVHVHPLLHHGPAQPHAHAHPHPHHHALPHPPPTHLSVPPRPWSYPRQAESDMSKPPCYEEAVLMAEPPPPYSEVLTDTRGLYRKIVTPFLSRRDSAEKQEQPPPSYKPLFLDRGYTSALHLPSAPRPAPPCPALCLQADRGRRVFPSWTDSELSSREPLEHGAWRLPVSIPLFGRTTAV

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes