Purified Membrane Proteins

Protein cornichon homolog 3 (CNIH-3) (Cornichon family AMPA receptor auxiliary protein 3)

Regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs). Promotes their targeting to the cell membrane and synapses and modulates their gating properties by regulating their rates of activation, deactivation and desensitization. {ECO:0000269|PubMed:20805473}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

CNIH3_HUMAN

Gene Name:

CNIH3

Uniprot Accession:

Q8TBE1

Origin:

Homo sapiens (Human)

Protein family:

Cornichon family

Full-length:

160

AA

Mass:

18976

Da

MAFTFAAFCYMLSLVLCAALIFFAIWHIIAFDELRTDFKSPIDQCNPVHARERLRNIERICFLLRKLVLPEYSIHSLFCIMFLCAQEWLTLGLNVPLLFYHFWRYFHCPADSSELAYDPPVVMNADTLSYCQKEAWCKLAFYLLSFFYYLYCMIYTLVSS

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes