Purified Membrane Proteins

Fibronectin type III domain-containing protein 9

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

FNDC9_HUMAN

Gene Name:

FNDC9 C5orf40

Uniprot Accession:

Q8TBE3

Origin:

Homo sapiens (Human)

Protein family:

Full-length:

224

AA

Mass:

25275

Da

MNIEVGNISYTGAIISWSSSEPCLEDYYHIMYRPNWNSIFSGYLRYSFHHEEKVPRTISSVVLEHLAPSTLYFLCISCKKAAFPYRHYCTMFHTLDKSPLAPGSSLVDPQISLWVLMAILLACFTAVLAFICLQFWCVRCHEPRWSYRAGHMEEANGLVRWPEEAPDLGQREEDLQGLPLVEMPRKNSRDGAELDPEANQDAPDAGALQRGGGDPPAILPHCGE

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes