Purified Membrane Proteins

Transmembrane protein 254

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

TM254_HUMAN

Gene Name:

TMEM254 C10orf57

Uniprot Accession:

Q8TBM7

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

123

AA

Mass:

14243

Da

MATAAGATYFQRGSLFWFTVITLSFGYYTWVVFWPQSIPYQNLGPLGPFTQYLVDHHHTLLCNGYWLAWLIHVGESLYAIVLCKHKGITSGRAQLLWFLQTFFFGIASLTILIAYKRKRQKQT

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes