Purified Membrane Proteins

Membrane protein FAM174A (Hepatitis C virus NS5A-transactivated protein 6) (HCV NS5A-transactivated protein 6) (Transmembrane protein 157)

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

F174A_HUMAN

Gene Name:

FAM174A NS5ATP6 TMEM157 UNQ1912/PRO4371

Uniprot Accession:

Q8TBP5

Origin:

Homo sapiens (Human)

Protein family:

FAM174 family

Full-length:

190

AA

Mass:

19954

Da

MKASQCCCCLSHLLASVLLLLLLPELSGPLAVLLQAAEAAPGLGPPDPRPRTLPPLPPGPTPAQQPGRGLAEAAGPRGSEGGNGSNPVAGLETDDHGGKAGEGSVGGGLAVSPNPGDKPMTQRALTVLMVVSGAVLVYFVVRTVRMRRRNRKTRRYGVLDTNIENMELTPLEQDDEDDDNTLFDANHPRR

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes