Purified Membrane Proteins

Small integral membrane protein 4

Mitochondrial ribosome-associated protein involved in the first steps of cytochrome c oxidase complex (complex IV) assembly.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

SMIM4_HUMAN

Gene Name:

SMIM4

Uniprot Accession:

Q8WVI0

Origin:

Homo sapiens (Human)

Protein family:

SMIM4

Full-length:

70

AA

Mass:

8696

Da

MFTRAQVRRILQRVPGKQRFGIYRFLPFFFVLGGTMEWIMIKVRVGQETFYDVYRRKASERQYQRRLEDE

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes