Purified Membrane Proteins

Transmembrane emp24 domain-containing protein 6 (p24 family protein gamma-5) (p24gamma5)

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

TMED6_HUMAN

Gene Name:

TMED6 UNQ9146/PRO34237

Uniprot Accession:

Q8WW62

Origin:

Homo sapiens (Human)

Protein family:

EMP24/GP25L family

Full-length:

240

AA

Mass:

27631

Da

MSPLLFGAGLVVLNLVTSARSQKTEPLSGSGDQPLFRGADRYDFAIMIPPGGTECFWQFAHQTGYFYFSYEVQRTVGMSHDRHVAATAHNPQGFLIDTSQGVRGQINFSTQETGFYQLCLSNQHNHFGSVQVYLNFGVFYEGPETDHKQKERKQLNDTLDAIEDGTQKVQNNIFHMWRYYNFARMRKMADFFLIQSNYNYVNWWSTAQSLVIILSGILQLYFLKRLFNVPTTTDTKKPRC

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes