Purified Membrane Proteins

Voltage-dependent calcium channel gamma-like subunit (Neuronal voltage-gated calcium channel gamma-like subunit) (Transmembrane protein 37)

Thought to stabilize the calcium channel in an inactivated (closed) state. Modulates calcium current when coexpressed with CACNA1G (By similarity). {ECO:0000250|UniProtKB:Q9JJV3}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

CCGL_HUMAN

Gene Name:

TMEM37 PR

Uniprot Accession:

Q8WXS4

Origin:

Homo sapiens (Human)

Protein family:

PMP-22/EMP/MP20 family, CACNG subfamily

Full-length:

190

AA

Mass:

20932

Da

MTAVGVQAQRPLGQRQPRRSFFESFIRTLIITCVALAVVLSSVSICDGHWLLAEDRLFGLWHFCTTTNQTICFRDLGQAHVPGLAVGMGLVRSVGALAVVAAIFGLEFLMVSQLCEDKHSQCKWVMGSILLLVSFVLSSGGLLGFVILLRNQVTLIGFTLMFWCEFTASFLLFLNAISGLHINSITHPWE

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes