Purified Membrane Proteins

Olfactory receptor 1E3 (Olfactory receptor 17-210) (OR17-210) (Olfactory receptor OR17-7)

Odorant receptor. {ECO:0000305}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

OR1E3_HUMAN

Gene Name:

OR1E3 OR1E3P

Uniprot Accession:

Q8WZA6

Origin:

Homo sapiens (Human)

Protein family:

G-protein coupled receptor 1 family

Full-length:

343

AA

Mass:

38518

Da

MMKKNQTMISEFLLLGLPIQPEQQNLFYALFLAVYLTTLLGNLLVIVLIRLDSHLHMPMYLCLSNLSFSDLCFSSVTMPKLLQNMQSQNPSIPFADCLAQMYFHLFYGVLESFLLVVMAYHCYVAICFPLHYTTIMSPKCCLGLLTLSWLLTTAHATLHTLLMARLSFCAENVIPHFFCDTSTLLKLACSNTQVNGWVMFFMGGLILVIPFLLLIMSCARIVSTILRVPSTGGIQKAFSTCGPHLSVVSLFYGTIIGLYLCPLTNHNTVKDTVMAVMYTGVTHMLNPFIYSLRNRDMRGNPGQSLQHKENFFVFKIVIVGILPLLNLVGVVKLIMKYHSKSVA

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes