Purified Membrane Proteins

Interferon alpha-inducible protein 27-like protein 1 (Interferon-stimulated gene 12c protein) (ISG12(c)) (ISG12C)

Plays a role in the apoptotic process and has a pro-apoptotic activity. {ECO:0000269|PubMed:27673746}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

I27L1_HUMAN

Gene Name:

IFI27L1 FAM14B

Uniprot Accession:

Q96BM0

Origin:

Homo sapiens (Human)

Protein family:

IFI6/IFI27 family

Full-length:

104

AA

Mass:

9549

Da

MGKESGWDSGRAAVAAVVGGVVAVGTVLVALSAMGFTSVGIAASSIAAKMMSTAAIANGGGVAAGSLVAILQSVGAAGLSVTSKVIGGFAGTALGAWLGSPPSS

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes