Purified Membrane Proteins

Cytochrome c oxidase assembly protein COX14

Core component of the MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase complex) complex, that regulates cytochrome c oxidase assembly. Requires for coordination of the early steps of cytochrome c oxidase assembly with the synthesis of MT-CO1.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

COX14_HUMAN

Gene Name:

COX14

Uniprot Accession:

Q96I36

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

57

AA

Mass:

6600

Da

MPTGKQLADIGYKTFSTSMMLLTVYGGYLCSVRVYHYFQWRRAQRQAAEEQKTSGIM

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes