Purified Membrane Proteins

Solute carrier family 35 member G5 (Acyl-malonyl-condensing enzyme 1-like protein 2)

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

S35G5_HUMAN

Gene Name:

SLC35G5 AMAC AMAC1L2

Uniprot Accession:

Q96KT7

Origin:

Homo sapiens (Human)

Protein family:

SLC35G solute transporter family

Full-length:

338

AA

Mass:

35161

Da

MAGSHPYFNLPDSTHPSPPSAPPSLRWHQRCQPSGATNGLLVALLGGGLPAGFVGPLSRMAYQGSNLPSLELLICRCLFHLPIALLLKLRGDPLLGPPDIRGWACFCALLNVLSIGCAYSAVQVVPAGNAATVRKGSSTVCSAVLTLCLESQGLGGYEWCGLLGSILGLIIILGPGLWTLQEGTTGVYTTLGYVQAFLGGLALSLGLLVYRSLHFPSCLPTVAFLSGLVGLLGCVPGLFVLQTPVLPSDLLSWSCVGAEGILALVSFTCVGYAVTKAHPALVCAVLHSEVVVALILQYYMLHETVALSDIMGAGVVLGSIAIITARNLSCERTGKVEE

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes