Purified Membrane Proteins

Putative membrane-spanning 4-domains subfamily A member 4E

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

M4A4E_HUMAN

Gene Name:

MS4A4E

Uniprot Accession:

Q96PG1

Origin:

Homo sapiens (Human)

Protein family:

MS4A family

Full-length:

132

AA

Mass:

15209

Da

MTTMQGMEQTTPGAGPDVPQLGNIDVIHSYLCKGLQEKFFKRKPKVLGVVRILIALMSLSMGIIMMCVAFSSYEEHPIFVYVAYTIWGSVMYPYQLQQELEQQKVWNYLKNLSWRIMGSYLCFGERSELKPL

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes