Purified Membrane Proteins

Membrane-spanning 4-domains subfamily A member 10 (CD20 antigen-like 7)

May be involved in signal transduction as a component of a multimeric receptor complex.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

M4A10_HUMAN

Gene Name:

MS4A10 CD20L7 MS4A9

Uniprot Accession:

Q96PG2

Origin:

Homo sapiens (Human)

Protein family:

MS4A family

Full-length:

267

AA

Mass:

29747

Da

MKAEATVIPSRCARGLPSWQVLSPVQPWQTSAPQNTTQPKLLAPHQHEKSQKKSSLLKELGAFHITIALLHLVFGGYLASIVKNLHLVVLKSWYPFWGAASFLISGILAITMKTFSKTYLKMLCLMTNLISLFCVLSGLFVISKDLFLESPFESPIWRMYPNSTVHIQRLELALLCFTVLELFLPVPTAVTAWRGDCPSAKNDDACLVPNTPLHLKGLPVEPPPSYQSVIQGDAQHKQHQRLREVKQVAPDTWIVTDGAAIWTQTAN

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes