Purified Membrane Proteins

Small integral membrane protein 14

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

SIM14_HUMAN

Gene Name:

SMIM14 C4orf34

Uniprot Accession:

Q96QK8

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

99

AA

Mass:

10710

Da

MAEGGFDPCECVCSHEHAMRRLINLLRQSQSYCTDTECLQELPGPSGDNGISVTMILVAWMVIALILFLLRPPNLRGSSLPGKPTSPHNGQDPPAPPVD

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes