Purified Membrane Proteins

Spermatogenesis-associated protein 25 (Testis-specific gene 23 protein)

May play a role in spermatogenesis. {ECO:0000269|PubMed:19240080}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

SPT25_HUMAN

Gene Name:

SPATA25 C20orf165 TSG23

Uniprot Accession:

Q9BR10

Origin:

Homo sapiens (Human)

Protein family:

SPATA25 family

Full-length:

227

AA

Mass:

23834

Da

MSYFRTPQTHPGPLPSGQGGAASPGLSLGLCSPVEPVVVASGGTGPLSQKAEQVAPAAQAWGPALAMPQARGCPGGTSWETLRKEYSRNCHKFPHVRQLESLGWDNGYSRSRAPDLGGPSRPRPLMLCGLSPRVLPVPSEAVGKEASSQPDICILTLAMMIAGIPTVPVPGVREEDLIWAAQAFMMAHPEPEGAVEGARWEQAHAHTASGKMPLVRSKRGQPPGSCL

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes