Purified Membrane Proteins

MARVEL domain-containing protein 1

Microtubule-associated protein that exhibits cell cycle-dependent localization and can inhibit cell proliferation and migration. {ECO:0000250}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

MALD1_HUMAN

Gene Name:

MARVELD1 MRVLDC1

Uniprot Accession:

Q9BSK0

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

173

AA

Mass:

18914

Da

MLPPPPRQPPPQARAARGAVRLQRPFLRSPLGVLRLLQLLAGAAFWITIATSKYQGPVHFALFVSVLFWLLTLGLYFLTLLGKHELVPVLGSRWLMVNVAHDVLAAALYGAATGIMSDQMQRHSYCNLKDYPLPCAYHAFLAAAVCGGVCHGLYLLSALYGCGRRCQGKQEVA

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes