Purified Membrane Proteins

Spermatogenesis-associated protein 9 (Testis development protein NYD-SP16)

May play a role in testicular development/spermatogenesis and may be an important factor in male infertility. {ECO:0000269|PubMed:12493713}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

SPAT9_HUMAN

Gene Name:

SPATA9

Uniprot Accession:

Q9BWV2

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

254

AA

Mass:

28740

Da

MPIKPVGWICGQVLKNFSGRIEGIQKAIMDLVDEFKDEFPTILRLSQSNQKREPAQKTSKIRMAIALAKINRATLIRGLNSISRSSKSVAKLLHPQLACRLLELRDISGRLLREVNAPRQPLYNIQVRKGSLFEIISFPAKTALTSIIYASYAALIYLAVCVNAVLKKVKNIFQEEESIRQNREESENCRKAFSEPVLSEPMFAEGEIKAKPYRSLPEKPDISDYPKLLANKQSNNIQVLHSVFDQSAEMNEQI

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes