Purified Membrane Proteins

TM2 domain-containing protein 2 (Beta-amyloid-binding protein-like protein 1) (BBP-like protein 1)

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

TM2D2_HUMAN

Gene Name:

TM2D2 BLP1

Uniprot Accession:

Q9BX73

Origin:

Homo sapiens (Human)

Protein family:

TM2 family

Full-length:

214

AA

Mass:

22871

Da

MVLGGCPVSYLLLCGQAALLLGNLLLLHCVSRSHSQNATAEPELTSAGAAQPEGPGGAASWEYGDPHSPVILCSYLPDEFIECEDPVDHVGNATASQELGYGCLKFGGQAYSDVEHTSVQCHALDGIECASPRTFLRENKPCIKYTGHYFITTLLYSFFLGCFGVDRFCLGHTGTAVGKLLTLGGLGIWWFVDLILLITGGLMPSDGSNWCTVY

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes