Purified Membrane Proteins

Putative transcript Y 13 protein

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

TTY13_HUMAN

Gene Name:

TTTY13 TTY13

Uniprot Accession:

Q9BZ97

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

58

AA

Mass:

6256

Da

MKTQDDGVLPPYDVNQLLGWDLNLSLFLGLCLMLLLAGSCLPSPGITGLSHGSNREDR

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes