Purified Membrane Proteins

Putative L-type amino acid transporter 1-like protein IMAA (hLAT1 3-transmembrane protein IMAA) (hLAT1 3TM IMAA) (hLAT1 3-transmembrane protein MMAA) (hLAT1 3TM MMAA)

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

LAT1L_HUMAN

Gene Name:

SLC7A5P2 IMAA MMAA

Uniprot Accession:

Q9GIP4

Origin:

Homo sapiens (Human)

Protein family:

Amino acid-polyamine-organocation (APC) superfamily, L-type amino acid transporter (LAT) (TC 2.A.3.8) family

Full-length:

190

AA

Mass:

19840

Da

MAGAGPKRRALAAPVAEEKEEAREKMMAAKRADGAAPAGEGEGVTLQGNITLLKGVAVIVVAIMSSGIFVTPTGVLKEAGSPGLALVVWAACGVFSIVGALCYAELGTTISKSGGDYAYMLDVYGSLPAFLKLWIELLIIRPSSQYIVALVFATYLLKPLFPTCPVPEEAAKLVACHSVQLIVHQPTQVI

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes