Purified Membrane Proteins

Cysteine-rich and transmembrane domain-containing protein 1

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

CYTM1_HUMAN

Gene Name:

CYSTM1 C5orf32 ORF1-FL49

Uniprot Accession:

Q9H1C7

Origin:

Homo sapiens (Human)

Protein family:

CYSTM1 family

Full-length:

97

AA

Mass:

10631

Da

MNQENPPPYPGPGPTAPYPPYPPQPMGPGPMGGPYPPPQGYPYQGYPQYGWQGGPQEPPKTTVYVVEDQRRDELGPSTCLTACWTALCCCCLWDMLT

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes