Purified Membrane Proteins

Olfactory receptor 51B5

Odorant receptor.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

O51B5_HUMAN

Gene Name:

OR51B5

Uniprot Accession:

Q9H339

Origin:

Homo sapiens (Human)

Protein family:

G-protein coupled receptor 1

Full-length:

312

AA

Mass:

35241

Da

MSSSGSSHPFLLTGFPGLEEAHHWISVFFLFMYISILFGNGTLLLLIKEDHNLHEPMYFFLAMLAATDLGLALTTMPTVLGVLWLDHREIGSAACFSQAYFIHSLSFLESGILLAMAYDRFIAICNPLRYTSVLTNTRVVKIGLGVLMRGFVSVVPPIRPLYFFLYCHSHVLSHAFCLHQDVIKLACADTTFNRLYPAVLVVFIFVLDYLIIFISYVLILKTVLSIASREERAKALITCVSHICCVLVFYVTVIGLSLIHRFGKQVPHIVHLIMSYAYFLFPPLMNPITYSVKTKQIQNAILHLFTTHRIGT

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes