Purified Membrane Proteins

Elongation of very long chain fatty acids protein 6 (EC 2.3.1.199) (3-keto acyl-CoA synthase ELOVL6) (ELOVL fatty acid elongase 6) (ELOVL FA elongase 6) (Fatty acid elongase 2) (hELO2) (Fatty acyl-CoA elongase) (Long-chain fatty-acyl elongase) (Very long chain 3-ketoacyl-CoA synthase 6) (Very long chain 3-oxoacyl-CoA synthase 6)

Catalyzes the first and rate-limiting reaction of the four reactions that constitute the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process allows the addition of 2 carbons to the chain of long- and very long-chain fatty acids (VLCFAs) per cycle. Condensing enzyme that elongates fatty acids with 12, 14 and 16 carbons with higher activity toward C16:0 acyl-CoAs. Catalyzes the synthesis of unsaturated C16 long chain fatty acids and, to a lesser extent, C18:0 and those with low desaturation degree. May participate in the production of saturated and monounsaturated VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators. {ECO:0000255|HAMAP-Rule:MF_03206, ECO:0000269|PubMed:19575253, ECO:0000269|PubMed:20937905, ECO:0000269|PubMed:25003994, ECO:0000269|PubMed:26214738}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

ELOV6_HUMAN

Gene Name:

ELOVL6 FACE LCE

Uniprot Accession:

Q9H5J4

Origin:

Homo sapiens (Human)

Protein family:

ELO family, ELOVL6 subfamily

Full-length:

265

AA

Mass:

31376

Da

MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes