Purified Membrane Proteins

Endogenous retroviral envelope protein HEMO (Endogenous retrovirus group MER34 member 1 Env polyprotein) (HERV-MER_4q12 provirus ancestral Env polyprotein) (Human endogenous MER34 (medium-reiteration-frequency-family-34) open reading frame) (Human endogenous MER34 ORF) (HEMO) [Cleaved into: Endogenous retroviral envelope protein HEMO, secreted form (Endogenous retroviral envelope protein HEMO, 48 kDa form)]

Endogenous envelope proteins originate from retroviral envelope proteins, which mediate receptor recognition and membrane fusion during early infection. Endogenous envelope proteins may have kept, lost or modified their original function during evolution. {ECO:0000305}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

MER34_HUMAN

Gene Name:

ERVMER34-1 HEMO LP9056

Uniprot Accession:

Q9H9K5

Origin:

Homo sapiens (Human)

Protein family:

Gamma type-C retroviral envelope protein family

Full-length:

563

AA

Mass:

63547

Da

MGSLSNYALLQLTLTAFLTILVQPQHLLAPVFRTLSILTNQSNCWLCEHLDNAEQPELVFVPASASTWWTYSGQWMYERVWYPQAEVQNHSTSSYRKVTWHWEASMEAQGLSFAQVRLLEGNFSLCVENKNGSGPFLGNIPKQYCNQILWFDSTDGTFMPSIDVTNESRNDDDDTSVCLGTRQCSWFAGCTNRTWNSSAVPLIGLPNTQDYKWVDRNSGLTWSGNDTCLYSCQNQTKGLLYQLFRNLFCSYGLTEAHGKWRCADASITNDKGHDGHRTPTWWLTGSNLTLSVNNSGLFFLCGNGVYKGFPPKWSGRCGLGYLVPSLTRYLTLNASQITNLRSFIHKVTPHRCTQGDTDNPPLYCNPKDNSTIRALFPSLGTYDLEKAILNISKAMEQEFSATKQTLEAHQSKVSSLASASRKDHVLDIPTTQRQTACGTVGKQCCLYINYSEEIKSNIQRLHEASENLKNVPLLDWQGIFAKVGDWFRSWGYVLLIVLFCLFIFVLIYVRVFRKSRRSLNSQPLNLALSPQQSAQLLVSETSCQVSNRAMKGLTTHQYDTSLL

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes