Purified Membrane Proteins

Plasminogen receptor (KT) (Plg-R(KT))

Receptor for plasminogen. Regulates urokinase plasminogen activator-dependent and stimulates tissue-type plasminogen activator-dependent cell surface plasminogen activation. Proposed to be part of a local catecholaminergic cell plasminogen activation system that regulates neuroendocrine prohormone processing. Involved in regulation of inflammatory response; regulates monocyte chemotactic migration and matrix metalloproteinase activation, such as of MMP2 and MMP9. {ECO:0000269|PubMed:21940822}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

PLRKT_HUMAN

Gene Name:

PLGRKT C9orf46 AD025 MDS030

Uniprot Accession:

Q9HBL7

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

147

AA

Mass:

17201

Da

MGFIFSKSMNESMKNQKEFMLMNARLQLERQLIMQSEMRERQMAMQIAWSREFLKYFGTFFGLAAISLTAGAIKKKKPAFLVPIVPLSFILTYQYDLGYGTLLERMKGEAEDILETEKSKLQLPRGMITFESIEKARKEQSRFFIDK

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes