Purified Membrane Proteins

Cutaneous T-cell lymphoma-associated antigen 1 (Protein cTAGE-1) (Cancer/testis antigen 21.1) (CT21.1)

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

CTGE1_HUMAN

Gene Name:

CTAGE1 CTAGE2

Uniprot Accession:

Q9HC47

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

74

AA

Mass:

8406

Da

MFVIISLHNCVVISFVLFLFGGNNFIQNFYLPQNYIDQFLLTSFPTFTSVGVLIVLVLCSAFLLLWQGEGVNLR

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes