Purified Membrane Proteins

Protein kish-B (Transmembrane protein 167B)

Involved in the early part of the secretory pathway. {ECO:0000269|PubMed:19942856}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

KISHB_HUMAN

Gene Name:

TMEM167B C1orf119 AD-020

Uniprot Accession:

Q9NRX6

Origin:

Homo sapiens (Human)

Protein family:

KISH family

Full-length:

74

AA

Mass:

8294

Da

MTNVYSLDGILVFGLLFVCTCAYFKKVPRLKTWLLSEKKGVWGVFYKAAVIGTRLHAAVAIACVVMAFYVLFIK

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes