Purified Membrane Proteins

Mitochondrial import receptor subunit TOM22 homolog (hTom22) (1C9-2) (Translocase of outer membrane 22 kDa subunit homolog)

Central receptor component of the translocase of the outer membrane of mitochondria (TOM complex) responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with the peripheral receptor TOM20 functions as the transit peptide receptor and facilitates the movement of preproteins into the translocation pore (PubMed:10982837). Required for the translocation across the mitochondrial outer membrane of cytochrome P450 monooxygenases (By similarity). {ECO:0000250|UniProtKB:Q75Q41, ECO:0000269|PubMed:10982837}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

TOM22_HUMAN

Gene Name:

TOMM22 TOM22

Uniprot Accession:

Q9NS69

Origin:

Homo sapiens (Human)

Protein family:

Tom22 family

Full-length:

142

AA

Mass:

15522

Da

MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes