Purified Membrane Proteins

Protein C19orf12

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

CS012_HUMAN

Gene Name:

C19orf12

Uniprot Accession:

Q9NSK7

Origin:

Homo sapiens (Human)

Protein family:

C19orf12 family

Full-length:

152

AA

Mass:

16286

Da

MERLKSHKPATMTIMVEDIMKLLCSLSGERKMKAAVKHSGKGALVTGAMAFVGGLVGGPPGLAVGGAVGGLLGAWMTSGQFKPVPQILMELPPAEQQRLFNEAAAIIRHLEWTDAVQLTALVMGSEALQQQLLAMLVNYVTKELRAEIQYDD

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes