Purified Membrane Proteins

UDP-glucuronic acid/UDP-N-acetylgalactosamine transporter (UDP-GlcA/UDP-GalNAc transporter) (Solute carrier family 35 member D1) (UDP-galactose transporter-related protein 7) (UGTrel7)

Transports both UDP-glucuronic acid (UDP-GlcA) and UDP-N-acetylgalactosamine (UDP-GalNAc) from the cytoplasm into the endoplasmic reticulum lumen (PubMed:11322953, PubMed:17952091). Plays a role in chondroitin sulfate biosynthesis, which is important for formation of cartilage extracellular matrix and normal skeletal development (By similarity). {ECO:0000250|UniProtKB:A2AKQ0, ECO:0000269|PubMed:11322953, ECO:0000269|PubMed:17952091}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

S35D1_HUMAN

Gene Name:

SLC35D1 KIAA0260 UGTREL7

Uniprot Accession:

Q9NTN3

Origin:

Homo sapiens (Human)

Protein family:

TPT transporter family, SLC35D subfamily

Full-length:

355

AA

Mass:

39240

Da

MAEVHRRQHARVKGEAPAKSSTLRDEEELGMASAETLTVFLKLLAAGFYGVSSFLIVVVNKSVLTNYRFPSSLCVGLGQMVATVAVLWVGKALRVVKFPDLDRNVPRKTFPLPLLYFGNQITGLFSTKKLNLPMFTVLRRFSILFTMFAEGVLLKKTFSWGIKMTVFAMIIGAFVAASSDLAFDLEGYAFILINDVLTAANGAYVKQKLDSKELGKYGLLYYNALFMILPTLAIAYFTGDAQKAVEFEGWADTLFLLQFTLSCVMGFILMYATVLCTQYNSALTTTIVGCIKNILITYIGMVFGGDYIFTWTNFIGLNISIAGSLVYSYITFTEEQLSKQSEANNKLDIKGKGAV

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes