Purified Membrane Proteins

Gap junction beta-4 protein (Connexin-30.3) (Cx30.3)

Structural component of gap junctions (By similarity). Gap junctions are dodecameric channels that connect the cytoplasm of adjoining cells. They are formed by the docking of two hexameric hemichannels, one from each cell membrane (By similarity). Small molecules and ions diffuse from one cell to a neighboring cell via the central pore (By similarity). {ECO:0000250|UniProtKB:P29033, ECO:0000250|UniProtKB:Q02738}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

CXB4_HUMAN

Gene Name:

GJB4

Uniprot Accession:

Q9NTQ9

Origin:

Homo sapiens (Human)

Protein family:

Connexin family, Beta-type (group I) subfamily

Full-length:

266

AA

Mass:

30419

Da

MNWAFLQGLLSGVNKYSTVLSRIWLSVVFIFRVLVYVVAAEEVWDDEQKDFVCNTKQPGCPNVCYDEFFPVSHVRLWALQLILVTCPSLLVVMHVAYREERERKHHLKHGPNAPSLYDNLSKKRGGLWWTYLLSLIFKAAVDAGFLYIFHRLYKDYDMPRVVACSVEPCPHTVDCYISRPTEKKVFTYFMVTTAAICILLNLSEVFYLVGKRCMEIFGPRHRRPRCRECLPDTCPPYVLSQGGHPEDGNSVLMKAGSAPVDAGGYP

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes