Purified Membrane Proteins

Transmembrane protein 14B

Primate-specific protein involved in cortical expansion and folding in the developing neocortex. May drive neural progenitor proliferation through nuclear translocation of IQGAP1, which in turn promotes G1/S cell cycle transitions. {ECO:0000269|PubMed:29033352}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

TM14B_HUMAN

Gene Name:

TMEM14B

Uniprot Accession:

Q9NUH8

Origin:

Homo sapiens (Human)

Protein family:

TMEM14 family

Full-length:

114

AA

Mass:

12078

Da

MEKPLFPLVPLHWFGFGYTALVVSGGIVGYVKTGSVPSLAAGLLFGSLAGLGAYQLYQDPRNVWGFLAATSVTFVGVMGMRSYYYGKFMPVGLIAGASLLMAAKVGVRMLMTSD

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes