Purified Membrane Proteins

Transmembrane protein 184C (Transmembrane protein 34)

Possible tumor suppressor which may play a role in cell growth. {ECO:0000269|PubMed:17072649}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

T184C_HUMAN

Gene Name:

TMEM184C TMEM34 PRO1355

Uniprot Accession:

Q9NVA4

Origin:

Homo sapiens (Human)

Protein family:

TMEM184 family

Full-length:

438

AA

Mass:

50142

Da

MPCTCTWRNWRQWIRPLVAVIYLVSIVVAVPLCVWELQKLEVGIHTKAWFIAGIFLLLTIPISLWVILQHLVHYTQPELQKPIIRILWMVPIYSLDSWIALKYPGIAIYVDTCRECYEAYVIYNFMGFLTNYLTNRYPNLVLILEAKDQQKHFPPLCCCPPWAMGEVLLFRCKLGVLQYTVVRPFTTIVALICELLGIYDEGNFSFSNAWTYLVIINNMSQLFAMYCLLLFYKVLKEELSPIQPVGKFLCVKLVVFVSFWQAVVIALLVKVGVISEKHTWEWQTVEAVATGLQDFIICIEMFLAAIAHHYTFSYKPYVQEAEEGSCFDSFLAMWDVSDIRDDISEQVRHVGRTVRGHPRKKLFPEDQDQNEHTSLLSSSSQDAISIASSMPPSPMGHYQGFGHTVTPQTTPTTAKISDEILSDTIGEKKEPSDKSVDS

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes