Purified Membrane Proteins

Putative sodium-coupled neutral amino acid transporter 7 (Solute carrier family 38 member 7)

Mediates sodium-dependent transport of amino acids, preferentially L-glutamine. {ECO:0000250}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

S38A7_HUMAN

Gene Name:

SLC38A7 SNAT7

Uniprot Accession:

Q9NVC3

Origin:

Homo sapiens (Human)

Protein family:

Amino acid/polyamine transporter 2 family

Full-length:

462

AA

Mass:

49966

Da

MAQVSINNDYSEWDLSTDAGERARLLQSPCVDTAPKSEWEASPGGLDRGTTSTLGAIFIVVNACLGAGLLNFPAAFSTAGGVAAGIALQMGMLVFIISGLVILAYCSQASNERTYQEVVWAVCGKLTGVLCEVAIAVYTFGTCIAFLIIIGDQQDKIIAVMAKEPEGASGPWYTDRKFTISLTAFLFILPLSIPREIGFQKYASFLSVVGTWYVTAIVIIKYIWPDKEMTPGNILTRPASWMAVFNAMPTICFGFQCHVSSVPVFNSMQQPEVKTWGGVVTAAMVIALAVYMGTGICGFLTFGAAVDPDVLLSYPSEDMAVAVARAFIILSVLTSYPILHFCGRAVVEGLWLRYQGVPVEEDVGRERRRRVLQTLVWFLLTLLLALFIPDIGKVISVIGGLAACFIFVFPGLCLIQAKLSEMEEVKPASWWVLVSYGVLLVTLGAFIFGQTTANAIFVDLLA

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes