Purified Membrane Proteins

Protein eva-1 homolog B (Protein FAM176B)

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

EVA1B_HUMAN

Gene Name:

EVA1B C1orf78 FAM176B

Uniprot Accession:

Q9NVM1

Origin:

Homo sapiens (Human)

Protein family:

EVA1 family

Full-length:

165

AA

Mass:

18374

Da

MDAPRRDMELLSNSLAAYAHIRANPESFGLYFVLGVCFGLLLTLCLLVISISWAPRPRPRGPAQRRDPRSSTLEPEDDDEDEEDTVTRLGPDDTLPGPELSAEPDGPLNVNVFTSAEELERAQRLEERERILREIWRTGQPDLLGTGTLGPSPTATGTLGRMHYY

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes