Purified Membrane Proteins

Trimeric intracellular cation channel type B (TRIC-B) (TRICB) (Transmembrane protein 38B)

Monovalent cation channel required for maintenance of rapid intracellular calcium release. May act as a potassium counter-ion channel that functions in synchronization with calcium release from intracellular stores. {ECO:0000250|UniProtKB:Q9DAV9}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

TM38B_HUMAN

Gene Name:

TMEM38B C9orf87

Uniprot Accession:

Q9NVV0

Origin:

Homo sapiens (Human)

Protein family:

TMEM38 family

Full-length:

291

AA

Mass:

32510

Da

MDSPWDELALAFSRTSMFPFFDIAHYLVSVMAVKRQPGAAALAWKNPISSWFTAMLHCFGGGILSCLLLAEPPLKFLANHTNILLASSIWYITFFCPHDLVSQGYSYLPVQLLASGMKEVTRTWKIVGGVTHANSYYKNGWIVMIAIGWARGAGGTIITNFERLVKGDWKPEGDEWLKMSYPAKVTLLGSVIFTFQHTQHLAISKHNLMFLYTIFIVATKITMMTTQTSTMTFAPFEDTLSWMLFGWQQPFSSCEKKSEAKSPSNGVGSLASKPVDVASDNVKKKHTKKNE

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes