Purified Membrane Proteins

Androgen-induced gene 1 protein (AIG-1) (Fatty acid esters of hydroxy fatty acids hydrolase AIG1) (FAHFA hydrolase AIG1) (EC 3.1.-.-)

Hydrolyzes bioactive fatty-acid esters of hydroxy-fatty acids (FAHFAs), but not other major classes of lipids (PubMed:27018888). Show a preference for FAHFAs with branching distal from the carboxylate head group of the lipids (PubMed:27018888). {ECO:0000269|PubMed:27018888}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

AIG1_HUMAN

Gene Name:

AIG1 CGI-103

Uniprot Accession:

Q9NVV5

Origin:

Homo sapiens (Human)

Protein family:

AIG1 family

Full-length:

238

AA

Mass:

27458

Da

MALVPCQVLRMAILLSYCSILCNYKAIEMPSHQTYGGSWKFLTFIDLVIQAVFFGICVLTDLSSLLTRGSGNQEQERQLKKLISLRDWMLAVLAFPVGVFVVAVFWIIYAYDREMIYPKLLDNFIPGWLNHGMHTTVLPFILIEMRTSHHQYPSRSSGLTAICTFSVGYILWVCWVHHVTGMWVYPFLEHIGPGARIIFFGSTTILMNFLYLLGEVLNNYIWDTQKSMEEEKEKPKLE

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes