Purified Membrane Proteins

Retinol dehydrogenase 8 (EC 1.1.1.300) (Photoreceptor outer segment all-trans retinol dehydrogenase) (Short chain dehydrogenase/reductase family 28C member 2)

Retinol dehydrogenase with a clear preference for NADP. Converts all-trans-retinal to all-trans-retinol. May play a role in the regeneration of visual pigment at high light intensity (By similarity). {ECO:0000250|UniProtKB:Q9N126}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

RDH8_HUMAN

Gene Name:

RDH8 PRRDH SDR28C2

Uniprot Accession:

Q9NYR8

Origin:

Homo sapiens (Human)

Protein family:

Short-chain dehydrogenases/reductases (SDR) family

Full-length:

311

AA

Mass:

33755

Da

MAAAPRTVLISGCSSGIGLELAVQLAHDPKKRYQVVATMRDLGKKETLEAAAGEALGQTLTVAQLDVCSDESVAQCLSCIQGEVDVLVNNAGMGLVGPLEGLSLAAMQNVFDTNFFGAVRLVKAVLPGMKRRRQGHIVVISSVMGLQGVIFNDVYAASKFALEGFFESLAIQLLQFNIFISLVEPGPVVTEFEGKLLAQVSMAEFPGTDPETLHYFRDLYLPASRKLFCSVGQNPQDVVQAIVNVISSTRPPLRRQTNIRYSPLTTLKTVDSSGSLYVRTTHRLLFRCPRLLNLGLQCLSCGCLPTRVRPR

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes