Purified Membrane Proteins

Vesicle transport protein USE1 (Putative MAPK-activating protein PM26) (USE1-like protein) (p31)

SNARE that may be involved in targeting and fusion of Golgi-derived retrograde transport vesicles with the ER. {ECO:0000269|PubMed:15272311}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

USE1_HUMAN

Gene Name:

USE1 USE1L MDS032

Uniprot Accession:

Q9NZ43

Origin:

Homo sapiens (Human)

Protein family:

USE1 family

Full-length:

259

AA

Mass:

29371

Da

MAASRLELNLVRLLSRCEAMAAEKRDPDEWRLEKYVGALEDMLQALKVHASKPASEVINEYSWKVDFLKGMLQAEKLTSSSEKALANQFLAPGRVPTTARERVPATKTVHLQSRARYTSEMRSELLGTDSAEPEMDVRKRTGVAGSQPVSEKQLAAELDLVLQRHQNLQEKLAEEMLGLARSLKTNTLAAQSVIKKDNQTLSHSLKMADQNLEKLKTESERLEQHTQKSVNWLLWAMLIIVCFIFISMILFIRIMPKLK

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes