Purified Membrane Proteins

CDGSH iron-sulfur domain-containing protein 1 (MitoNEET)

Plays a key role in regulating maximal capacity for electron transport and oxidative phosphorylation (By similarity). May be involved in Fe-S cluster shuttling and/or in redox reactions. {ECO:0000250, ECO:0000269|PubMed:17584744, ECO:0000269|PubMed:17766440}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

CISD1_HUMAN

Gene Name:

CISD1 C10orf70 ZCD1 MDS029

Uniprot Accession:

Q9NZ45

Origin:

Homo sapiens (Human)

Protein family:

CISD protein family

Full-length:

108

AA

Mass:

12199

Da

MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes