Purified Membrane Proteins

Killer cell lectin-like receptor subfamily F member 1 (Lectin-like receptor F1) (Activating coreceptor NKp80) (C-type lectin domain family 5 member C)

Involved in the natural killer (NK)-mediated cytolysis of PHA-induced lymphoblasts.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

KLRF1_HUMAN

Gene Name:

KLRF1 CLEC5C ML

Uniprot Accession:

Q9NZS2

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

231

AA

Mass:

26563

Da

MQDEERYMTLNVQSKKRSSAQTSQLTFKDYSVTLHWYKILLGISGTVNGILTLTLISLILLVSQGVLLKCQKGSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLKYQGKCYWFSNEMKSWSDSYVYCLERKSHLLIIHDQLEMAFIQKNLRQLNYVWIGLNFTSLKMTWTWVDGSPIDSKIFFIKGPAKENSCAAIKESKIFSETCSSVFKWICQY

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes