Purified Membrane Proteins

Protein cornichon homolog 4 (CNIH-4) (Cornichon family AMPA receptor auxiliary protein 4)

Involved in G protein-coupled receptors (GPCRs) trafficking from the endoplasmic reticulum to the cell surface; it promotes the exit of GPCRs from the early secretory pathway, likely through interaction with the COPII machinery (PubMed:24405750). {ECO:0000269|PubMed:24405750}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

CNIH4_HUMAN

Gene Name:

CNIH4 HSPC163

Uniprot Accession:

Q9P003

Origin:

Homo sapiens (Human)

Protein family:

Cornichon family

Full-length:

139

AA

Mass:

16093

Da

MEAVVFVFSLLDCCALIFLSVYFIITLSDLECDYINARSCCSKLNKWVIPELIGHTIVTVLLLMSLHWFIFLLNLPVATWNIYRYIMVPSGNMGVFDPTEIHNRGQLKSHMKEAMIKLGFHLLCFFMYLYSMILALIND

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes